PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc040924.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 188aa    MW: 20901.6 Da    PI: 10.3943
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc040924.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR167.14.5e-2118104290
                     FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnH 87 
                               Yn+YA +vGFsvrk k++++  +++++++tf Csk  +++++++    +  ++   rtgC a ++   + +g+w vtk e+ HnH
  Itr_sc040924.1_g00001.1  18 LYNDYAFRVGFSVRKGKQRYQGSTKNVKMKTFLCSKASSKSKKNSG--VKGYSKIDLRTGCGAYIQFDVDGNGVWTVTKHEKAHNH 101
                              7************************************999998777..78889999****************************** PP

                     FAR1  88 ela 90 
                              +l+
  Itr_sc040924.1_g00001.1 102 TLS 104
                              *97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.1E-1718104IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
DQDLVGIVVS NGDEAYELYN DYAFRVGFSV RKGKQRYQGS TKNVKMKTFL CSKASSKSKK  60
NSGVKGYSKI DLRTGCGAYI QFDVDGNGVW TVTKHEKAHN HTLSTKDKSH LLRSHRRVGN  120
NQLSYLRDLK KSGVALADGI RFLKHKSGGS PLVGFTNRDA YNSLASDSLK SLDGTDSNSL  180
IEIFRRMQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015574673.11e-57PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14143211
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-14FAR1-related sequence 5